Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415465.1	complete	133	48-449(+)
Amino Acid sequence :
MASSKFCGIILVIAILFHSTISSACGTCQTKPKPKPPSSSPSASPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCALLDGLADLEAALCLCTAIKANVLGLNLNVPVTLSLLIS ACQKSVPPGFQCE*
Physicochemical properties
Number of amino acids:		133
Molecular weight:		13,485.975
Theoretical pI:		8.522
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 625
Instability index:		50.289
aromaticity		0.023
GRAVY		0.643
Secondary Structure Fraction
Helix		0.301
turn		0.316
sheet		0.271