Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415476.1 | complete | 113 | 33-374(+) |
Amino Acid sequence : | |||
MSPKYLLFLLIAVVVLTTYSSLVDADVDGYKYKRPHYPPKHYPPKKHYPPTEEEESSTTGIVDEEKASTTAEEDAKDYYKKRPPYYKPTHYKPPNTSQPNTSLPNKSLQLAID* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 11,843.097 | ||
Theoretical pI: | 11.222 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 78.066 | ||
aromaticity | 0.038 | ||
GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.267 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415476.1 | complete | 105 | 103-420(+) |
Amino Acid sequence : | |||
MLMLMATSTSDHIILQSIILQKNTILLQKKRSPPPLALLMRKKLQQLQKKMLRTTTRKGLHIISQPITSHPIQANPIQASPIKASNWPLISPSFNNYVISISCSF* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,843.097 | ||
Theoretical pI: | 11.222 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 78.066 | ||
aromaticity | 0.038 | ||
GRAVY | -0.005 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.267 | ||
sheet | 0.229 |