Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415481.1 | complete | 104 | 58-372(+) |
Amino Acid sequence : | |||
MGVASRLMLVVVLMIAITSNEVVKVANAQSICNASVSDLMACKSSVTAPNPTPPSASCCSVLSHADLSCLCSYKNSNVLPSLGIDPKLAMQLPAKCKLPHPANY* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 10,802.701 | ||
Theoretical pI: | 8.530 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
Instability index: | 41.579 | ||
aromaticity | 0.019 | ||
GRAVY | 0.449 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.317 | ||
sheet | 0.288 |