Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415493.1	complete	133	48-449(+)
Amino Acid sequence :
MASSKFCGIILVIAIPFHSTFSSACGTCQTKPKPRPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCALLDGLADLEAALCLCTAIKANVLGLNLNVPVTLSLLIS ACQKSVPPGFQCE*
Physicochemical properties
Number of amino acids:		133
Molecular weight:		13,558.000
Theoretical pI:		8.528
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 625
Instability index:		57.200
aromaticity		0.030
GRAVY		0.559
Secondary Structure Fraction
Helix		0.293
turn		0.331
sheet		0.256