Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415506.1	complete	101	20-325(+)
Amino Acid sequence :
MEEFRKEFNKQHPNNKAVSAVGKAAGAKWKSMSVAEKAPYQAKAEKRKVEYEKNIKAYNLKQAEGANAAEEEGSDEKSVSEVNDEEDGDDDGSEEEEDDDE*
Physicochemical properties
Number of amino acids:		101
Molecular weight:		11,257.851
Theoretical pI:		4.524
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		56.413
aromaticity		0.059
GRAVY		-1.497
Secondary Structure Fraction
Helix		0.139
turn		0.218
sheet		0.366