Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415507.1	internal	158	1-474(+)
Amino Acid sequence :
CEVQSVMEVNNQRSFLTLNALNEFDPKYSGVDWRLKLETQRGAVLATELKNNANKMARWTAQALLASADMMKLGYVSRVHPRDHFNHVILAVVGYKPREFSTQINLNTANMWGIVKSIVD LCMKLNEGKYVLVKDPQKPQVRIYEVPSNAFENDYMEE
Physicochemical properties
Number of amino acids:		158
Molecular weight:		18,137.640
Theoretical pI:		7.937
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		25440 25565
Instability index:		21.901
aromaticity		0.089
GRAVY		-0.364
Secondary Structure Fraction
Helix		0.316
turn		0.215
sheet		0.285