Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415515.1 | 5prime_partial | 185 | 2-559(+) |
Amino Acid sequence : | |||
REIDGVYTTNFPDEPPYYYDFTADSCPEGLALTIQGTRVKVLEYNEGVKIVFQGTNLIDSAQNHPMHLHGHSFYVVGYGVGNYNNLTDPLTFNFFDPPRVNTFSVPRNGWLAIRFFANNP GVWFWHCHIERHMSLGMDTVFIVKNGSTVDTSIRQPPAYMPPCKDPSDIQMQNASNFYDNQLENL* | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 21,118.373 | ||
Theoretical pI: | 5.178 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
Instability index: | 39.183 | ||
aromaticity | 0.141 | ||
GRAVY | -0.397 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.292 | ||
sheet | 0.162 |