Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415520.1 | 5prime_partial | 116 | 1-351(+) |
Amino Acid sequence : | |||
TGVGVWNALXLEIVMTFGLVYTVYATAIDKKSGNVVIIAPIAIGFIVGANILAGGAFDGGSMNPAVSFGPAVVSWSWDNHWVYWLGPFIGGGIAALVYETVFTTCLSEQTTDYSQI* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 12,122.768 | ||
Theoretical pI: | 4.139 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 34950 | ||
Instability index: | 27.335 | ||
aromaticity | 0.139 | ||
GRAVY | 0.733 | ||
Secondary Structure Fraction | |||
Helix | 0.417 | ||
turn | 0.270 | ||
sheet | 0.209 |