Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415543.1 | internal | 177 | 1-531(+) |
Amino Acid sequence : | |||
ILVNNAAKFSTKRTIEVTAEDFSMIMATNFESCYHLCQLGHPLLKASENGSIVFISFIAAGISLPYVSIYAASKGAMNQLTKTLACEWAKDNIRSNAVAPRITKISLVESTLRESAQMKE GESPEMKEVLQTLIDRTPIGRIAEVEDVSSLIAFLCLPAASYITGPGYLCGWWIYCE | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 19,420.274 | ||
Theoretical pI: | 5.481 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25815 | ||
Instability index: | 37.333 | ||
aromaticity | 0.085 | ||
GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.226 | ||
sheet | 0.305 |