Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415559.1 | 5prime_partial | 141 | 3-428(+) |
Amino Acid sequence : | |||
NKQLDQMGYNIGVRLVDEFLAKSNVSRCVDFKETAEVIAKVGLKMFLGVGASVTNWDADGTCCSIVLEDNPLVDFVELPDTCQGLYYCNILSGVLRGALEMVSMKTEVTWARDMLRGDDA FELKVKLLNQVPEEYPYKDDE* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,781.901 | ||
Theoretical pI: | 4.440 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
Instability index: | 14.401 | ||
aromaticity | 0.085 | ||
GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.191 | ||
sheet | 0.284 |