Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415579.1 | complete | 130 | 58-450(+) |
Amino Acid sequence : | |||
MATSVTTTLPQFNGLRSSTFSSLPTTKMATIHPIKRKGNGALGARCDFIGSPTNLIMVTTTSLMLFAGRFGLAPSANRKATAGLRLEIRDSGLQTGDPAGFTLADTLACGSVGHIIGVGV VLGLKNIGAL* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 13,332.383 | ||
Theoretical pI: | 10.518 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 42.907 | ||
aromaticity | 0.046 | ||
GRAVY | 0.306 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.292 | ||
sheet | 0.262 |