Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415602.1 | 3prime_partial | 178 | 535-2(-) |
Amino Acid sequence : | |||
MTQLIRIDLYLYLPREEYQLHRKQTQHKSKNIRWRESPQPSIRSMISTSRTINVTTLVADEALHNTWTFWAMHFIWCFTSNIWNINLTTMRHLHNNLVTIFLKPNLKTLLTNRHLPLLKL FQHSQNCDPMTNQNDIRPFGEYCPTFLVFVGYKLVNFLSHWVHSYRLFRFSEKQALYP | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 15,228.727 | ||
Theoretical pI: | 8.898 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
Instability index: | 53.084 | ||
aromaticity | 0.090 | ||
GRAVY | -0.182 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.224 | ||
sheet | 0.194 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415602.1 | 5prime_partial | 134 | 2-406(+) |
Amino Acid sequence : | |||
GIESLFFTKSKKPVAMNPVTQEIHKLISYKNEKGWAILTKGSNIILVGHGVTILRVLEEFEKWKVSIREKGFEIGFKEYRNKIIVQVPHCCQIDIPNIAGKAPDKMHCPECPRVMESFIS YKCCHIDGPASAYH* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,228.727 | ||
Theoretical pI: | 8.898 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
Instability index: | 53.084 | ||
aromaticity | 0.090 | ||
GRAVY | -0.182 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.224 | ||
sheet | 0.194 |