Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415614.1 | 5prime_partial | 121 | 2-367(+) |
Amino Acid sequence : | |||
LRRRIAEESLIKTVRNVAGDQLSHKAAKEMITTWFLDSDVSRCGKDAWFDDEAFFKWNDDSRNYEDMLKELRVQEVLLQLTNIGDSMSDLQALPQGLSALLSKVEPSTRAQLVDELRKVL C* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,872.623 | ||
Theoretical pI: | 5.020 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 55.543 | ||
aromaticity | 0.066 | ||
GRAVY | -0.408 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.165 | ||
sheet | 0.314 |