Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415616.1 | 5prime_partial | 125 | 3-380(+) |
Amino Acid sequence : | |||
DEELQRIQDPVTVVCTRLEKAIDMLQAEVNSKQATRVVQTLFKIIRNVIEHPSQMKYRRLRKNNPIIQSNVANYKAAMEFLFLIGFSEDVVADEIGKAETYLVLKRNDPGLLWLAKSSLE TLITY* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 14,395.537 | ||
Theoretical pI: | 8.035 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 48.172 | ||
aromaticity | 0.072 | ||
GRAVY | -0.182 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.160 | ||
sheet | 0.288 |