Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415623.1 | 5prime_partial | 191 | 2-577(+) |
Amino Acid sequence : | |||
DISLADYIGVVPAKHATYVPHTAGRYSVKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAMEIIHLLTDSNPIQVIVEAVVNSGPREDATRIGSAGVVRRQAVDISPLRRVNQA IYLLTTGARESAFRNIKSIAECLADELINAAKGSSNSYAIKKKDEIERVAKANRWFECWVTVLVAARRNLF* | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 13,685.357 | ||
Theoretical pI: | 9.442 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 39.620 | ||
aromaticity | 0.111 | ||
GRAVY | 0.527 | ||
Secondary Structure Fraction | |||
Helix | 0.462 | ||
turn | 0.179 | ||
sheet | 0.376 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415623.1 | complete | 117 | 282-635(+) |
Amino Acid sequence : | |||
MLLELALLELLDAKLWIFLPCDVSIKLSIFSLLVLVNQLLETSNLLLNVWPMNSLMLLKDHPTVMQSRRRTRLKELRRPTVGLSVGLPSLLLQEETFFRAFQFGYLCFTLLSWKFKF* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,685.357 | ||
Theoretical pI: | 9.442 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 39.620 | ||
aromaticity | 0.111 | ||
GRAVY | 0.527 | ||
Secondary Structure Fraction | |||
Helix | 0.462 | ||
turn | 0.179 | ||
sheet | 0.376 |