Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415639.1 | 5prime_partial | 104 | 2-316(+) |
Amino Acid sequence : | |||
HGMSIDSRHMKLLADVMTFRGEVLGITRFGIQKMDKSILMLASFEKTADHLFNASVNGRDDKIEGVSECIIMGIPMPIGTGMFKVRQRVDVPQELNYGQRPILS* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,637.522 | ||
Theoretical pI: | 8.130 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 32.731 | ||
aromaticity | 0.058 | ||
GRAVY | -0.071 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.231 | ||
sheet | 0.240 |