Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415656.1 | complete | 115 | 101-448(+) |
Amino Acid sequence : | |||
MVANGDAPAIGSAAAAASLRTRRTTSRAAAAGGGASSMLQFYTDEAAGRKIVTKHCSDHEHWVHRCCRYAPCFWEAVPHLQLGWFYHIQESRVHQWRNLIERFKWIASDNQKGTL* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,896.427 | ||
Theoretical pI: | 9.336 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32220 | ||
Instability index: | 45.998 | ||
aromaticity | 0.104 | ||
GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.191 | ||
sheet | 0.270 |