Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415668.1 | 5prime_partial | 104 | 1-315(+) |
Amino Acid sequence : | |||
KTMGLSDQDIVALSGGHTLGRCHKERSGFEGAWTSNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPAFRSLVEKYAADEDAFFIDYAESHLKLSELGFAVA* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,413.648 | ||
Theoretical pI: | 4.780 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 37.275 | ||
aromaticity | 0.106 | ||
GRAVY | -0.220 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.240 | ||
sheet | 0.337 |