Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415674.1 | 5prime_partial | 122 | 1-369(+) |
Amino Acid sequence : | |||
ILRECAVHENQAAMLFNSKLSNEVDRLSKDLNDTNIVYVDIYYPILDMIQNPNKYGFKIANRGCCGTGRLEVSILCNKFNPATCVDDTGYVFWDSFHPTEKAYKILVHDILTRYITRLVT SN* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 12,652.756 | ||
Theoretical pI: | 7.601 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25815 | ||
Instability index: | 25.345 | ||
aromaticity | 0.170 | ||
GRAVY | 0.379 | ||
Secondary Structure Fraction | |||
Helix | 0.443 | ||
turn | 0.132 | ||
sheet | 0.123 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415674.1 | complete | 106 | 324-4(-) |
Amino Acid sequence : | |||
MNKNFVGFFCGMETIPKYITSVIHTRSWIELVTQYRYLQPPCTTTTSVCYLKTIFIWILDHIKYWIVDINVDDVCVIQVFAKTVYFIREFRVEQHCCLVFMNSTFS* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,652.756 | ||
Theoretical pI: | 7.601 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25815 | ||
Instability index: | 25.345 | ||
aromaticity | 0.170 | ||
GRAVY | 0.379 | ||
Secondary Structure Fraction | |||
Helix | 0.443 | ||
turn | 0.132 | ||
sheet | 0.123 |