Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415684.1 | 3prime_partial | 169 | 119-625(+) |
Amino Acid sequence : | |||
MKQFKVQVDQHEQESSSRLPSPDIFGKSVYTFYIGQNDFTSNLADIGIDGVKQFMPQVVYQIISTVKGLYEIGGRTFMVQNLAPVGCYPAFLVQLPHNISDIDEFGCLISYNKAVVDYNN MLKDALAQSRQSLQNASLIYVDTFSVLLDLFQRPTSHGLKYGTKSMLWT | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 19,048.542 | ||
Theoretical pI: | 5.844 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
Instability index: | 42.133 | ||
aromaticity | 0.118 | ||
GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.243 | ||
sheet | 0.189 |