Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415692.1	5prime_partial	113	2-343(+)
Amino Acid sequence :
PGKRVKMSPKYLLFLLIAVVVLTTYSSLVDADVDGYKYKRPHYPPKHYPPKKHYPPTEEEESSTTGIVDEEKASTTAEEDAKDYYKKRPPYRKPPHYKPPHYKPPHYKPPTAN*
Physicochemical properties
Number of amino acids:		113
Molecular weight:		13,126.794
Theoretical pI:		9.328
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19370 19370
Instability index:		84.000
aromaticity		0.124
GRAVY		-1.188
Secondary Structure Fraction
Helix		0.257
turn		0.257
sheet		0.186