Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415693.1 | complete | 100 | 111-413(+) |
Amino Acid sequence : | |||
MSIPDDGNVSTDFIENWVKIGLPAKNKVKTENGSTSFAELCTCCEKEAVNTSLGNLLTYPYVRDGLVNKTLGLKGGYYDFVKGSFELWGLDFGLSPSVSV* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,862.180 | ||
Theoretical pI: | 4.761 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 30.985 | ||
aromaticity | 0.110 | ||
GRAVY | -0.102 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.310 | ||
sheet | 0.210 |