Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415708.1	complete	133	48-449(+)
Amino Acid sequence :
MASSKFCGIILVIAILFRSTFSSACGTCQTKPKPKPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCALLDGLADLEAALCLCTAIKANVLGLNLNVPVTLSLLIS ACQKSVPPGFQCE*
Physicochemical properties
Number of amino acids:		133
Molecular weight:		13,565.075
Theoretical pI:		8.688
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 625
Instability index:		59.272
aromaticity		0.030
GRAVY		0.595
Secondary Structure Fraction
Helix		0.301
turn		0.323
sheet		0.263