Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415710.1 | 5prime_partial | 112 | 1-339(+) |
Amino Acid sequence : | |||
KSIGMIDNVPGMKALDMNSAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKKLGLPNAVDGSYNLESVEPEMILAAVDSTEVVEAEKTNQKK* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 11,855.669 | ||
Theoretical pI: | 4.798 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 19.990 | ||
aromaticity | 0.018 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.241 | ||
sheet | 0.357 |