Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415723.1	5prime_partial	159	2-481(+)
Amino Acid sequence :
IEKTMEWDQGLQILAANYYPACPQPDLAIGIPPHTDHGLITLLTQNHMGGLQVQHKGQWVNWNALPNSFVVNLGDQTQILSNDKYKSVWHRATVNNKATRISIAVPHGPALNKVVVPVPE LLEREGQAPIYKGMSYKDYMELQQSSTAYMKPCLDFIRI*
Physicochemical properties
Number of amino acids:		159
Molecular weight:		17,890.345
Theoretical pI:		7.176
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		32430 32555
Instability index:		53.336
aromaticity		0.082
GRAVY		-0.310
Secondary Structure Fraction
Helix		0.314
turn		0.245
sheet		0.233