Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415744.1 | 5prime_partial | 102 | 2-310(+) |
Amino Acid sequence : | |||
GLMGDDHDYFEKGNLDIFSGRGVCLNAPVCSILITSDNTGDLPGWYVEYVEITTAGLHVPAESIQFKLNQWLAVDEPPFELTAYRDYCPSTTYSQYPSVLIS* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,341.534 | ||
Theoretical pI: | 4.114 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 31.926 | ||
aromaticity | 0.127 | ||
GRAVY | -0.091 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.265 | ||
sheet | 0.216 |