Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415748.1	5prime_partial	154	2-466(+)
Amino Acid sequence :
DDKLGVLCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLDMINDPHYLYRMTVLHSISLLANVMGSEITCSKLLPVVTNASKDRVPNVKFNVAKVLQSFIPVVDQSVVEKT IHPCLVELIEDPDVDVRFFASQALQSIDQVMSDI*
Physicochemical properties
Number of amino acids:		154
Molecular weight:		17,336.936
Theoretical pI:		5.064
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15595
Instability index:		40.547
aromaticity		0.065
GRAVY		0.110
Secondary Structure Fraction
Helix		0.364
turn		0.188
sheet		0.240