Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415748.1 | 5prime_partial | 154 | 2-466(+) |
Amino Acid sequence : | |||
DDKLGVLCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLDMINDPHYLYRMTVLHSISLLANVMGSEITCSKLLPVVTNASKDRVPNVKFNVAKVLQSFIPVVDQSVVEKT IHPCLVELIEDPDVDVRFFASQALQSIDQVMSDI* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 17,336.936 | ||
Theoretical pI: | 5.064 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 40.547 | ||
aromaticity | 0.065 | ||
GRAVY | 0.110 | ||
Secondary Structure Fraction | |||
Helix | 0.364 | ||
turn | 0.188 | ||
sheet | 0.240 |