Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415768.1 | 5prime_partial | 124 | 2-376(+) |
Amino Acid sequence : | |||
KQGDTIKSGTVIRLHHMRTRRWLHSHLYASPITGNQEVSCFGGDTESDTGDHWRLVIEGSGKTXNQDQKVRLQHVDTGVYLHSHDKKYTRIAGGQQEVCAVKEKRADNVRLAAEGVYLPI IGTN* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,776.264 | ||
Theoretical pI: | 8.983 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 31.776 | ||
aromaticity | 0.057 | ||
GRAVY | -0.719 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.211 | ||
sheet | 0.171 |