Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415776.1	complete	133	48-449(+)
Amino Acid sequence :
MASSKFCGIILVIAILFHSTISSACGTCQTKPKPKPPSSSPSPSTSPVAHCPKDALKLGACVNQLGLVNVPIGTPISSKCCALLDGLADLEAALCLCTAIKANVLGLNLNVPVTLSLLIS ACQKSVPPGFQCE*
Physicochemical properties
Number of amino acids:		133
Molecular weight:		13,530.973
Theoretical pI:		8.522
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 625
Instability index:		49.722
aromaticity		0.023
GRAVY		0.569
Secondary Structure Fraction
Helix		0.293
turn		0.316
sheet		0.256