Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415788.1 | 5prime_partial | 154 | 2-466(+) |
Amino Acid sequence : | |||
IECFSFLNRALENEMAPILVVATNRGITTIRGTNYKSPHGIPVDLLDRLLIISTQPYTEQEIRKILDIRCQEEEVEMSEEAKILLTKIGVDTSLRYAIHLITISALACQKRKGKIVEMED INRVYHLFLDVKRSTQYLMEYQSQYMFNEDGDRR* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 17,927.506 | ||
Theoretical pI: | 5.682 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
Instability index: | 53.027 | ||
aromaticity | 0.071 | ||
GRAVY | -0.262 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.156 | ||
sheet | 0.279 |