Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415794.1	internal	99	3-299(+)
Amino Acid sequence :
FSCSICRNVMTLPVTTPCAHNFCKSCLEGAFAGKSFVRERSRGGRSLRAQKNVMNCPSCSLDISDFLQNIQVNTELTDVIESLKTKAEEVENSDNASDD
Physicochemical properties
Number of amino acids:		99
Molecular weight:		10,881.142
Theoretical pI:		5.353
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 375
Instability index:		56.123
aromaticity		0.051
GRAVY		-0.341
Secondary Structure Fraction
Helix		0.232
turn		0.273
sheet		0.222