Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415796.1 | 5prime_partial | 141 | 3-428(+) |
Amino Acid sequence : | |||
EDVEYLMKINYYPPCPRPDLTLGVVAHTDLSCLTILVPNEVPGLQVFKDEHWYDAKYILNALIIHIGDQIEIGSNGKYKAVLHRTTVDKNKTRMSWPVFLEPPAEKIVGPLPQLVNQDNP PKYKYKKFKDYSYCKLNKLPQ* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 16,286.726 | ||
Theoretical pI: | 8.388 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
Instability index: | 45.050 | ||
aromaticity | 0.106 | ||
GRAVY | -0.432 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.227 | ||
sheet | 0.206 |