Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415822.1 | internal | 183 | 2-550(+) |
Amino Acid sequence : | |||
KASSIIKEALYVLSFGSSDFLQNYYVNPWINKVYTPDQYSSFLAGQLSSFVKELYGLGARKIGVTSLPPLGCLPAAITLFGFHKPGCVSRINYDARGFNKKINSTVSNLQKQSPDLKIVI FDIFTPLYDVVKSPSNYGFAEARRGCCGTGTVETTSFLCNRKSIGTCSNATQYVFRDSVHPSE | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 20,139.745 | ||
Theoretical pI: | 9.125 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20775 | ||
Instability index: | 34.840 | ||
aromaticity | 0.126 | ||
GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.301 | ||
sheet | 0.164 |