Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415877.1	complete	119	48-407(+)
Amino Acid sequence :
MASSKFCGIILVIAILFHSTFSSACGTCQTKPKPKPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCALLDGLADLEAALCLCTAIKANVLGLKLECACYSQSAY*
Physicochemical properties
Number of amino acids:		119
Molecular weight:		12,153.343
Theoretical pI:		8.510
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 3605
Instability index:		64.460
aromaticity		0.042
GRAVY		0.550
Secondary Structure Fraction
Helix		0.286
turn		0.303
sheet		0.277