Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415890.1	complete	133	42-443(+)
Amino Acid sequence :
MASSKFCGIILVIAILFHSTFSSACGTCQTKPKPKPPSSSPSPSPSPVAHCPKDALKLGACVNLLGLVNVPIGTPISSKCCALLDGLADLEAALCPCTAIKANVLGLNLNVPVTLSLLIS ACQKSVPPGFQCE*
Physicochemical properties
Number of amino acids:		133
Molecular weight:		13,529.986
Theoretical pI:		8.522
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 625
Instability index:		55.402
aromaticity		0.030
GRAVY		0.564
Secondary Structure Fraction
Helix		0.293
turn		0.331
sheet		0.256