Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415893.1	5prime_partial	124	2-376(+)
Amino Acid sequence :
KQEKSKSSGNIFSIFSNFKLPLPFMKPKQAPTKDDAKEARVGNEEYPSQKPDVVRFPRVQFTVPPPVVVENEEPGKTSNPIILWQVYALGGFLVVRWIWARWNERKAQNDSSNDDQPDDQ PSAE*
Physicochemical properties
Number of amino acids:		124
Molecular weight:		14,156.719
Theoretical pI:		6.563
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24980 24980
Instability index:		57.485
aromaticity		0.105
GRAVY		-0.841
Secondary Structure Fraction
Helix		0.274
turn		0.298
sheet		0.177