Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415895.1 | 5prime_partial | 113 | 2-343(+) |
Amino Acid sequence : | |||
NNINNSASFADGGGGGPVLSVEMDYNSRNFQKVTTPTSLSPVLPRSPNFAKSPFSNSHHTELSSRNTQNLNKPTTPSVSSIDISQQMLSLLTRCNDVVTNMTGLLGYVPYHPL* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,180.419 | ||
Theoretical pI: | 8.145 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 48.823 | ||
aromaticity | 0.062 | ||
GRAVY | -0.437 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.416 | ||
sheet | 0.168 |