Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415910.1 | 3prime_partial | 166 | 53-550(+) |
Amino Acid sequence : | |||
MVKYSREPDNHTKSCKARGSDLRVHFKNTRETAHAIRKLPLGKAKRYLEDVLAHKQAIPFRRFCRGVGRTAQAKNRHSNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDSLHVSHIQV NQAQKRRRRTYRAHGRINPYMSSPCHIELTLSEKEEPVKKEPESQL | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 19,112.663 | ||
Theoretical pI: | 10.283 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 63.299 | ||
aromaticity | 0.054 | ||
GRAVY | -0.962 | ||
Secondary Structure Fraction | |||
Helix | 0.229 | ||
turn | 0.217 | ||
sheet | 0.235 |