Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415919.1 | 5prime_partial | 174 | 1-525(+) |
Amino Acid sequence : | |||
LFLARKVSLVRAILYMVAQCFGAICGCGLVKAFQKSHYNRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSF GAAVMYNDEKTWDHHWIFWVGPFIGAAIAAFYHQYILRAGAAKALGSFRSSAAI* | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 18,690.501 | ||
Theoretical pI: | 9.513 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
Instability index: | 31.267 | ||
aromaticity | 0.132 | ||
GRAVY | 0.434 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.230 | ||
sheet | 0.259 |