Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415921.1 | 5prime_partial | 150 | 1-453(+) |
Amino Acid sequence : | |||
NRSLHIFLHRIFIFNSRKMASITITSPVVRASVVHKPCLGAPSSPIFALPALAKKGKVRCSMEIKKGSDPKVNSNKGMGASLMAAAASTMSSPAMALVDERMSTEGTGLPFGLSNNLLGW ILFGMFGVIWALYFIYASSLEEDEESGLSL* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 12,958.167 | ||
Theoretical pI: | 6.567 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 47.793 | ||
aromaticity | 0.067 | ||
GRAVY | 0.303 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.250 | ||
sheet | 0.333 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415921.1 | complete | 120 | 386-24(-) |
Amino Acid sequence : | |||
MTPNMPKRIQPRRLLLNPKGSPVPSVLILSSTKAMAGLDMVDAAAAINDAPIPLFELTFGSEPFLISIEHLTFPFFANAGNAKIGEEGAPKQGLWTTLARTTGEVIVMDAIFLELKIKIL * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 12,958.167 | ||
Theoretical pI: | 6.567 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 47.793 | ||
aromaticity | 0.067 | ||
GRAVY | 0.303 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.250 | ||
sheet | 0.333 |