Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415950.1 | internal | 127 | 3-383(+) |
Amino Acid sequence : | |||
ENPFNYTGINSTDPTVLYPQMGTKVILVNYNDTVEIIWQGTNIGNAENHPMHPHGFSFYLVGTGYGNFDNQTSPSTYNLVNPPEVNTIGVPKNGWASIRFIADNPGVWFMHCHLERHATW GMNAVLI | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,207.725 | ||
Theoretical pI: | 5.515 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 30940 | ||
Instability index: | 26.328 | ||
aromaticity | 0.126 | ||
GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.339 | ||
sheet | 0.157 |