Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415986.1 | 5prime_partial | 131 | 3-398(+) |
Amino Acid sequence : | |||
FYGVYDILKSSYLRSPEGRKRIQHMKEEIEELNAMEQLELGPIRTLIYGAIAGACSEAATYPFEVVRRQLQMQVRARRLSTLSTCVKIVEQGGIPALYVGLVPSLLQVLPSAAISYFVYE FMKIVLKVESS* | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,761.131 | ||
Theoretical pI: | 8.586 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
Instability index: | 62.665 | ||
aromaticity | 0.092 | ||
GRAVY | 0.144 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.198 | ||
sheet | 0.313 |