Acc_NO	ORF type	length	start-end position (strand +/-)
>EY415989.1	complete	117	50-403(+)
Amino Acid sequence :
MLLELALLELLDAKLWIFLPCDVSIKLSIFSLLVLVNQLLETSNLLLNVWPMNSLMLLKDHPTVMQSRRRTRLKELRRLTVDLSVGLPSLLLQEETFFKAFQXGYLCLTLLSWKFTF*
Physicochemical properties
Number of amino acids:		117
Molecular weight:		13,523.163
Theoretical pI:		8.709
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		17990 18115
Instability index:		41.025
aromaticity		0.095
GRAVY		0.569
Secondary Structure Fraction
Helix		0.466
turn		0.164
sheet		0.397