Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY415994.1 | complete | 100 | 50-352(+) |
Amino Acid sequence : | |||
MLVPGKIQHVICTGNLCIKEIHDYLKTICPDLHITRGEYDEEPKYPETKTLTIGQFKLGLCHGHQVIPWGDLDSLAMLQRQLDVDILVNRSYSSVYCIQT* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,413.124 | ||
Theoretical pI: | 5.879 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
Instability index: | 37.492 | ||
aromaticity | 0.070 | ||
GRAVY | -0.125 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.180 | ||
sheet | 0.200 |