Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY416007.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
TLSVGCITAAFFDTKEPIEFTVQNLYRGIVPKLIIEVVMVWVSIISRRLTANLVEDEVGQAIISRVPPFIVQSFLYPFNVVSTVMAEQGRSQVNPKFNDWRMCFNHLKATNQLKRGSSFF YRRDYKLIAGGRYSIKRYF* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 16,064.546 | ||
Theoretical pI: | 9.823 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 43.116 | ||
aromaticity | 0.137 | ||
GRAVY | 0.071 | ||
Secondary Structure Fraction | |||
Helix | 0.396 | ||
turn | 0.216 | ||
sheet | 0.180 |