Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY416025.1 | 5prime_partial | 154 | 3-467(+) |
Amino Acid sequence : | |||
CFVALGSLRISVEMAAIYSLYIINKSGGLIFYKDYGSAGRMDTNDSLRVASLWHSMHAISQQLSPISGCSGIELLQADTFDLHCFQSLTGTKFFVVCEPGTQHMEVLLKHIYELYTDCVL KNPFYEMEMPIRCELFDINLNQAIQKDRVTLMGR* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 17,429.036 | ||
Theoretical pI: | 5.667 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16305 | ||
Instability index: | 40.080 | ||
aromaticity | 0.104 | ||
GRAVY | 0.136 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.208 | ||
sheet | 0.266 |