Acc_NO	ORF type	length	start-end position (strand +/-)
>EY416088.1	internal	128	3-386(+)
Amino Acid sequence :
RCLVFNFTCMEMKDGEQPEHANCSPEGLVKQVKTATKSAKVELAGENALERYDARAYSQVLATSRSDSGNASCAFTFLRMNKRLFEGDNWRHLVEFVKNMSQGGRDNKLSEHDCGRTDLY VGFIREKN
Physicochemical properties
Number of amino acids:		128
Molecular weight:		14,503.163
Theoretical pI:		7.808
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10220
Instability index:		45.288
aromaticity		0.086
GRAVY		-0.683
Secondary Structure Fraction
Helix		0.234
turn		0.227
sheet		0.273