Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY416088.1 | internal | 128 | 3-386(+) |
Amino Acid sequence : | |||
RCLVFNFTCMEMKDGEQPEHANCSPEGLVKQVKTATKSAKVELAGENALERYDARAYSQVLATSRSDSGNASCAFTFLRMNKRLFEGDNWRHLVEFVKNMSQGGRDNKLSEHDCGRTDLY VGFIREKN | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,503.163 | ||
Theoretical pI: | 7.808 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 45.288 | ||
aromaticity | 0.086 | ||
GRAVY | -0.683 | ||
Secondary Structure Fraction | |||
Helix | 0.234 | ||
turn | 0.227 | ||
sheet | 0.273 |