Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EY416099.1 | 5prime_partial | 107 | 3-326(+) |
Amino Acid sequence : | |||
SYQVSATAAAKVVDISKRIGLTDKICASMEVMKSADQKYHVSDITRSVATATGTAALTAATITGSAATAAGTAIVNSSYFAKGAHLVSEILSRAAKAAADLGTQGSK* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 10,722.033 | ||
Theoretical pI: | 9.416 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 13.291 | ||
aromaticity | 0.037 | ||
GRAVY | 0.199 | ||
Secondary Structure Fraction | |||
Helix | 0.224 | ||
turn | 0.196 | ||
sheet | 0.308 |