| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >FB669268.1 | 5prime_partial | 251 | 1-756(+) |
Amino Acid sequence : | |||
| KSNLSTADLSQLCPIGLNHLSSLQIQQIQAQIQLNQQQQLMISRAMQARNYNLGVRSQPMKLAAAAAPPQPKPTKLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAA YKLRGDYARLNFPHLKHTGAHLAPGGPLHSSVDAKLQAICQSLEQNKSSNSNSSKKEKRGDAVEEKSDKVVVVVAEGEESCSSSSMNTGSASSPSSEIESLDFTEVPWDESEDFVLRKYP SWEIDWDAILS* | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 27,873.027 | ||
| Theoretical pI: | 8.388 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 42065 | ||
| Instability index: | 53.959 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.598 | ||
Secondary Structure Fraction | |||
| Helix | 0.251 | ||
| turn | 0.263 | ||
| sheet | 0.279 | ||