| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >FB875091.1 | complete | 349 | 1-1050(+) |
Amino Acid sequence : | |||
| MANLNGAASDLRKTFLGVYSTLKSELLNDPAFEWTDGSRQWVERMLDYNVPGGKLNRGLSVIDSYQLLKEGKDLTDDEVFLASALGWCIEWLQAYFLVLDDIMDNSHTRRGQPCWFKVPK VGMIAINDGIILRNHIPRILKKHFRSKPYYVDLLDLFNEVEFQTASGQMIDLITTIEGEKDLSKYSLPLHRRIVQYKTAYYSFYLPVACALLMAGENLENHPTVKDVLIDMGIYFQVQDD YLDCFGEPEKIGKIGTDIEDFKCSWLVVKALELCNEEQKKTLFEHYGKENPADVAKIKALYNDINLQGMFADFESKSYEKITSSIEAHPSKSVQAVLKSFLGKIYKRQK* | |||
Physicochemical properties | |||
| Number of amino acids: | 349 | ||
| Molecular weight: | 39,990.451 | ||
| Theoretical pI: | 5.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 58330 58705 | ||
| Instability index: | 31.581 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.268 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.198 | ||
| sheet | 0.261 | ||